Home > Product > Catalog Peptides > Others > Peptide YY (3-36) (human)

Others

Peptide YY (3-36) (human)

[Price Inquiry]
CAT#
P04007
Sequence
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
M.W/Mr.
4049.52
Molecular Formula
C180H279N53O54
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.