Peptide YY (3-36) is a Y2 receptor antagonist. It reduces food intake and modulates brain activity in the appetite centers in humans.
CAT# | R1849 |
CAS | 123583-37-9 |
Synonyms/Alias | PYY; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine |
M.F/Formula | C180H279N53O54 |
M.W/Mr. | 4049.55 |
Sequence | One Letter Code: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide) Three Letter Code: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
Purity | ≥95% |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...