Home > Product > Antimicrobial Peptides > Perinerin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3281
Sequence
FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY
Host Chemicals
Perinereis aibuhitensis
Length
51
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.