Home > Product > Antimicrobial Peptides > PgAFP

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3325
Sequence
LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
Host Chemicals
Penicillium chrysogenum RP42C
Length
58
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.