Home > Product > Antimicrobial Peptides > PgAFP

Antimicrobial Peptides

CAT#
AF3325
Sequence
LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV
Host Chemicals
Penicillium chrysogenum RP42C
Length
58
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.