Pheromone biosynthesis-activating neuropeptide I

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	P37013
Sequence	RLSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

CAT#	Product Name	Inquiry
X20111	UP_P84307	Inquiry
X08736	PM_17340009	Inquiry
X20018	UP_P83724	Inquiry
X21182	EGFR Protein Tyrosine Kinase Substrate	Inquiry
X00914	PH1BS041_06	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl Hexapeptide-12, a natural powerful antiager

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

CXCR4 antagonist-TC 14012

TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...

The function of Margatoxin in blocking K+ channels

Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	34
Modifications	Leucine amide