Home > Product > Catalog Peptides > Others > Pheromone biosynthesis-activating neuropeptide I

Others

Pheromone biosynthesis-activating neuropeptide I

[Price Inquiry]
CAT#
P37013
Sequence
RLSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
Modifications
Leucine amide
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.