Home > Product > Catalog Peptides > Others > Pheromone biosynthesis-activating neuropeptide I

Others

Pheromone biosynthesis-activating neuropeptide I

Price Inquiry
CAT#
P37013
Sequence
RLSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
Modifications
Leucine amide
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.