Home > Product > Catalog Peptides > Others > Pheromone biosynthesis-activating neuropeptide II

Others

Pheromone biosynthesis-activating neuropeptide II

[Price Inquiry]
CAT#
P37014
Sequence
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
Modifications
Leucine amide
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.