Home > Product > Catalog Peptides > Others > Pheromone biosynthesis-activating neuropeptide

Others

warning All products are for research use only. Not for human use.

Pheromone biosynthesis-activating neuropeptide

[Price Inquiry]
CAT#
P37004
Sequence
LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL
Modifications
Leucine amide
Length
33
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.