Home > Product > Catalog Peptides > Others > PHI-27 (porcine)

Others

warning All products are for research use only. Not for human use.

PHI-27 (porcine)

[Price Inquiry]
CAT#
V02012
Sequence
HADGVFTSDFSRLLGQLSAKKYLESLI-NH2
M.W/Mr.
2995.43
Molecular Formula
C136H216N36O40
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.