Home > Product > Catalog Peptides > Others > PHI-27 (rat)

Others

PHI-27 (rat)

[Price Inquiry]
CAT#
V02013
Sequence
HADGVFTSDYSRLLGQISAKKYLESLI-NH2
M.W/Mr.
3011.43
Molecular Formula
C136H216N36O41
Length
27
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.