Home > Product > Catalog Peptides > Others > PI1

Others

CAT#
P15001
Sequence
LYCEPNTRFKQECNWCTCSANGEYATCTLLYCGPR
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.