Home > Product > Antimicrobial Peptides > PI230

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3160
Sequence
NTCENLAGSYKGVCFGGCDRHCRTQEGAISGRCRDDFRCWCTKNC
Host Chemicals
Pisum sativum
Length
45
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.