Home > Product > Antimicrobial Peptides > Pilosulin 4

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Pilosulin 4

[Price Inquiry]
CAT#
AF2496
Sequence
FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
Host Chemicals
Myrmecia banksi
Length
36
Activity
Antibacterial
SwissProt ID
Q68Y22
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.