Home > Product > Antimicrobial Peptides > Pilosulin 1

Antimicrobial Peptides

Pilosulin 1

[Price Inquiry]
CAT#
AF3316
Sequence
GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
Host Chemicals
venom of Myrmecia pilosula (jumper ant)
Length
56
Activity
Gram+ & Gram-, Fungi, Mammalian cells,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.