Home > Product > Catalog Peptides > Others > Pilosulin-1

Others

warning All products are for research use only. Not for human use.

Pilosulin-1

[Price Inquiry]
CAT#
P25001
Sequence
GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
Length
56
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.