Home > Product > Catalog Peptides > Others > Pilosulin-1 65->112

Others

Pilosulin-1 65->112

[Price Inquiry]
CAT#
P25002
Sequence
LARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.