Home > Product > Catalog Peptides > Others > Pilosulin-4

Others

Pilosulin-4

[Price Inquiry]
CAT#
P25009
Sequence
FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
Length
36
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.