Home > Product > Antimicrobial Peptides > Piscidin 4

Antimicrobial Peptides

Piscidin 4

[Price Inquiry]
CAT#
AF3081
Sequence
FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP
Host Chemicals
Morone chrysops x Morone saxatilis
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.