Home > Product > Antimicrobial Peptides > Piscidin-like antimicrobial peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Piscidin-like antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2907
Sequence
RCIALFFVLSLVVLMAEPGEGFFFHIIKGLFHAGKMIHGLI
Host Chemicals
Epinephelus bleekeri
Length
41
Activity
Antimicrobial
SwissProt ID
F1CNA6
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.