Home > Product > Antimicrobial Peptides > Piscidin-like peptide

Antimicrobial Peptides

Piscidin-like peptide

[Price Inquiry]
CAT#
AF2908
Sequence
RCIALFLVLSLVALMAEPGEGFIFHIIKGLVHAGKMIHGLV
Host Chemicals
Epinephelus fuscoguttatus
Length
41
Activity
Antimicrobial
SwissProt ID
D5KS96
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.