Home > Product > Antimicrobial Peptides > Plantaricin C19

Antimicrobial Peptides

Plantaricin C19

[Price Inquiry]
CAT#
AF2648
Sequence
KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHHKC
Host Chemicals
Lactobacillus plantarum C19
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.