Home > Product > Antimicrobial Peptides > Plantaricin 163

Antimicrobial Peptides

Plantaricin 163

[Price Inquiry]
CAT#
AF2161
Sequence
VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK
Host Chemicals
Lactobacillus plantarum 163
Length
32
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.