Home > Product > Antimicrobial Peptides > Plantaricin 423

Antimicrobial Peptides

Plantaricin 423

[Price Inquiry]
CAT#
AF3004
Sequence
KNYGNGVHCTKKGCSVDWGYAWANIANNSVMNGLTGGNAGWHN
Host Chemicals
Lactobacillus plantarum 423
Length
43
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.