Home > Product > Antimicrobial Peptides > Plantaricin 423

Antimicrobial Peptides

Plantaricin 423

Price Inquiry
CAT#
AF3004
Sequence
KNYGNGVHCTKKGCSVDWGYAWANIANNSVMNGLTGGNAGWHN
Host Chemicals
Lactobacillus plantarum 423
Length
43
Activity
Antibacterial

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.