Home > Product > Antimicrobial Peptides > Plectasin

Antimicrobial Peptides

CAT#
AF2829
Sequence
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
Host Chemicals
Pseudoplectania nigrella
Length
40
Activity
Antibacterial
SwissProt ID
Q53I06
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.