Home > Product > Antimicrobial Peptides > PMAP-36

Antimicrobial Peptides

CAT#
AF2685
Sequence
VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
Host Chemicals
Sus scrofa
Length
37
Activity
Antibacterial
SwissProt ID
P49931
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.