Home > Product > Antimicrobial Peptides > Ponericin-G2

Antimicrobial Peptides

Ponericin-G2

[Price Inquiry]
CAT#
AF1955
Sequence
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ
Host Chemicals
Pachycondyla goeldii
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P82415
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.