Home > Product > Antimicrobial Peptides > Pp-AMP1

Antimicrobial Peptides

CAT#
AF3094
Sequence
KSCCRSTQARNIYNAPRFAGGSRPLCALGSGCKIVDDKKTPPND
Host Chemicals
Phyllostachys edulis
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.