Home > Product > Antimicrobial Peptides > PP113

Antimicrobial Peptides

CAT#
AF2939
Sequence
GKWGWIYITILFADVGGFKSSRHPEERRVQERRFKRITRGPD
Host Chemicals
Pteromalus puparum
Length
42
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.