Home > Product > Antimicrobial Peptides > PP113

Antimicrobial Peptides

CAT#
AF2939
Sequence
GKWGWIYITILFADVGGFKSSRHPEERRVQERRFKRITRGPD
Host Chemicals
Pteromalus puparum
Length
42
Activity
Antibacterial

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.