Home > Product > Catalog Peptides > Others > Prepro-ANF (26-55), human

Others

warning All products are for research use only. Not for human use.

Prepro-ANF (26-55), human

[Price Inquiry]
CAT#
A17033
Sequence
NPMYNAVSNADLMDFKNLLDHLEEKMPLED
M.W/Mr.
3508.0
Molecular Formula
C152H236N38O51S3
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.