Home > Product > Antimicrobial Peptides > Prepro-beta-defensin 1

Antimicrobial Peptides

Prepro-beta-defensin 1

[Price Inquiry]
CAT#
AF2399
Sequence
VSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCK
Host Chemicals
Sus scrofa
Length
34
Activity
Antimicrobial
SwissProt ID
H9ZGM8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.