Home > Product > Catalog Peptides > Others > Prepro VIP (81-122), human

Others

Prepro VIP (81-122), human

[Price Inquiry]
CAT#
V02021
Sequence
ADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
M.W/Mr.
4552.2
Molecular Formula
C202H325N53O64S1
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.