CAT# | G01018 |
M.F/Formula | C198H312N62O58 |
M.W/Mr. | 4489.1 |
Sequence | TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...