Home > Product > Catalog Peptides > Others > Preprogalanin 28-67, rat

Others

Preprogalanin 28-67, rat

Price Inquiry
CAT#
G01018
Sequence
TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP
M.W/Mr.
4489.1
Molecular Formula
C198H312N62O58
Length
40

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.