Home > Product > Catalog Peptides > Others > Preprogalanin 28-67, rat

Others

warning All products are for research use only. Not for human use.

Preprogalanin 28-67, rat

[Price Inquiry]
CAT#
G01018
Sequence
TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP
M.W/Mr.
4489.1
Molecular Formula
C198H312N62O58
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.