Home > Product > Catalog Peptides > Various Products / Diabetes > Preptin, Human Pro-Insulin Growth Factor II (96-129), human

Various Products / Diabetes

Preptin, Human Pro-Insulin Growth Factor II (96-129), human

[Price Inquiry]
CAT#
I02009
Sequence
DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
M.W/Mr.
4029.5
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.