Home > Product > Catalog Peptides > Others > Preptin, Human Pro-Insulin Growth Factor II (67-100), rat

Others

warning All products are for research use only. Not for human use.

Preptin, Human Pro-Insulin Growth Factor II (67-100), rat

[Price Inquiry]
CAT#
I02007
Sequence
DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
M.W/Mr.
3932.4
Length
34
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.