Home > Product > Catalog Peptides > Various Products / Diabetes > Preptin, Human Pro-Insulin Growth Factor II (67-100), rat

Various Products / Diabetes

Preptin, Human Pro-Insulin Growth Factor II (67-100), rat

Price Inquiry
CAT#
I02007
Sequence
DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
M.W/Mr.
3932.4
Length
34

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.