Home > Product > Catalog Peptides > Others > (Pro3) Gastric Inhibitory Peptide (GIP), human

Others

(Pro3) Gastric Inhibitory Peptide (GIP), human

[Price Inquiry]
CAT#
G02007
Sequence
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
M.W/Mr.
4951.6
Molecular Formula
C226H338N60O64S1
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.