β-Amyloid (1-42), (1-40), (1-46) and Fragments

[Pro31]-beta-Amyloid (1-42)

[Price Inquiry]
CAT#
A13300
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA
M.W/Mr.
4498.1
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.