Home > Product > Antimicrobial Peptides > Probable antimicrobial peptide Con13

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Probable antimicrobial peptide Con13

[Price Inquiry]
CAT#
AF2797
Sequence
SKIKDFAKKAWNSPLANELKSKALNAAKNFVSEKIGATP
Host Chemicals
Opisthacanthus cayaporum
Length
39
Activity
Antibacterial, Antifungal
SwissProt ID
C7C1L2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.