Home > Product > Catalog Peptides > Others > Prolactin Releasing Peptide (1-31), bovine

Others

Prolactin Releasing Peptide (1-31), bovine

[Price Inquiry]
CAT#
P13002
Sequence
SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
M.W/Mr.
3576.1
Molecular Formula
C157H244N54O41S
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.