Home > Product > Catalog Peptides > Others > Prolactin Releasing Peptide (1-31), human

Others

warning All products are for research use only. Not for human use.

Prolactin Releasing Peptide (1-31), human

[Price Inquiry]
CAT#
P13003
Sequence
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
M.W/Mr.
3664.2
Molecular Formula
C160H252N56O42S
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.