Home > Product > Catalog Peptides > Others > Prolactin Releasing Peptide (1-31), human

Others

Prolactin Releasing Peptide (1-31), human

Price Inquiry
CAT#
P13003
Sequence
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
M.W/Mr.
3664.2
Molecular Formula
C160H252N56O42S
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.