Home > Product > Antimicrobial Peptides > Proline-rich antimicrobial peptide 1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Proline-rich antimicrobial peptide 1

[Price Inquiry]
CAT#
AF2563
Sequence
DIQIPGIKKPTHRDIIIPNWNPNVRTQPWQRFGGNKS
Host Chemicals
Galleria mellonella
Length
37
Activity
Antibacterial, Antifungal
SwissProt ID
P85214
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.