Home > Product > Antimicrobial Peptides > Proline-rich antimicrobial peptide 2

Antimicrobial Peptides

Proline-rich antimicrobial peptide 2

[Price Inquiry]
CAT#
AF2933
Sequence
EIRLPEPFRFPSPTVPKPIDIDPILPHPWSPRQTYPIIARRS
Host Chemicals
Galleria mellonella
Length
42
Activity
Antibacterial
SwissProt ID
P85212
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.