Home > Product > Antimicrobial Peptides > Propionicin-F

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Propionicin-F

[Price Inquiry]
CAT#
AF3046
Sequence
WFYQGMNIAIYANIGGVANIIGYTEAAVATLLGAVVAVAPVVP
Host Chemicals
Propionibacterium freudenreichii subsp. freudenreichii
Length
43
Activity
Antibacterial
SwissProt ID
Q6E3K9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.