Home > Product > Catalog Peptides > Others > Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)

Others

warning All products are for research use only. Not for human use.

Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)

[Price Inquiry]
CAT#
H09876
Sequence
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
M.W/Mr.
4551.5
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.