Home > Product > Catalog Peptides > Others > protease inhibitor SGPI-5Bt

Others

protease inhibitor SGPI-5Bt

[Price Inquiry]
CAT#
P15007
Sequence
EVNCTPGATFKNKCNTCRCGSNGRSASCTLMACPPGSY
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.