Home > Product > Antimicrobial Peptides > Psacotheasin

Antimicrobial Peptides

Psacotheasin

[Price Inquiry]
CAT#
AF2339
Sequence
CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK
Host Chemicals
Psacothea hilaris
Length
34
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.