Home > Product > Antimicrobial Peptides > Psalmopeotoxin-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Psalmopeotoxin-1

[Price Inquiry]
CAT#
AF2173
Sequence
ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
Host Chemicals
Psalmopoeus cambridgei
Length
33
Activity
Antiparasitic
SwissProt ID
P0C201
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.