Home > Product > Antimicrobial Peptides > pSAS10

Antimicrobial Peptides

CAT#
AF3225
Sequence
KTCENLVDTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDVRCWCTRNC
Host Chemicals
seeds, cowpea, Vigna unguiculata
Length
47
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.