Antimicrobial Peptides

CAT#
AF3208
Sequence
KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC
Host Chemicals
Pea seeds, Pisum sativvm
Length
46
Activity
Fungi,
SwissProt ID
PDB ID: 1JKZ
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.