Home > Product > Antimicrobial Peptides > PsDef1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3273
Sequence
RMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP
Host Chemicals
Scots pine, Pinus sylvestris
Length
50
Activity
Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.