Home > Product > Antimicrobial Peptides > Pseudo-hevein

Antimicrobial Peptides

Pseudo-hevein

Price Inquiry
CAT#
AF3132
Sequence
EQCGRQAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCKGGG
Host Chemicals
Hevea brasiliensis
Length
45
Activity
Antifungal
SwissProt ID
P80359

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.