Home > Product > Antimicrobial Peptides > Pseudo-hevein

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Pseudo-hevein

[Price Inquiry]
CAT#
AF3132
Sequence
EQCGRQAGGKLCPNNLCCSQYGWCGSSDDYCSPSKNCQSNCKGGG
Host Chemicals
Hevea brasiliensis
Length
45
Activity
Antifungal
SwissProt ID
P80359
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.