Home > Product > Catalog Peptides > Others > PSI 1

Others

CAT#
A40008
Sequence
RCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCP
Length
46
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.