Home > Product > Catalog Peptides > Others > PSI 2

Others

CAT#
A40009
Sequence
YCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHL
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.